Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [255765] (2 PDB entries) |
Domain d3bsga1: 3bsg A:348-404 [155525] Other proteins in same PDB: d3bsga2 automated match to d1ht6a1 complexed with ca; mutant |
PDB Entry: 3bsg (more details), 1.95 Å
SCOPe Domain Sequences for d3bsga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsga1 b.71.1.0 (A:348-404) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsaagndyavwek
Timeline for d3bsga1: