SCOPe 2.03: Domain d3bsga1: 3bsg A:348-404

Lineage for d3bsga1 (3bsg A:348-404)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Plant alpha-amylase [51040] (2 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (8 PDB entries)

8. Domain d3bsga1: 3bsg A:348-404 [155525]
   Other proteins in same PDB: d3bsga2
   automatically matched to d1ht6a1
   complexed with ca; mutant

Details for d3bsga1

PDB Entry: 3bsg, 1.95 Å

PDB Description: barley alpha-amylase isozyme 1 (amy1) h395a mutant

PDB Compounds: (A:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d3bsga1:

Sequence; same for both SEQRES and ATOM records:

>d3bsga1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsaagndyavwek

Timeline for d3bsga1:

• d3bsga1 first appeared in SCOP 1.75
  
• d3bsga1 appears in SCOPe 2.02
  
• d3bsga1 appears in SCOPe 2.04
  
• d3bsga1 appears in the current release, SCOPe 2.08