| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Plant alpha-amylase [51040] (2 species) single beta-sheet; probable result of a decay of the common-fold |
| Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (8 PDB entries) |
| Domain d3bsga1: 3bsg A:348-404 [155525] Other proteins in same PDB: d3bsga2 automatically matched to d1ht6a1 complexed with ca; mutant |
PDB Entry: 3bsg (more details), 1.95 Å
SCOPe Domain Sequences for d3bsga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsga1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsaagndyavwek
Timeline for d3bsga1: