SCOPe 2.01: Domain d3bsba_: 3bsb A:

Lineage for d3bsba_ (3bsb A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein Pumilio 1 [63612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63613] (12 PDB entries)

8. Domain d3bsba_: 3bsb A: [155522]
   automated match to d1m8yb_
   protein/RNA complex

Details for d3bsba_

PDB Entry: 3bsb, 2.8 Å

PDB Description: crystal structure of human pumilio1 in complex with cyclinb reverse rna

PDB Compounds: (A:) Pumilio homolog 1

SCOPe Domain Sequences for d3bsba_:

Sequence; same for both SEQRES and ATOM records:

>d3bsba_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
rsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilqa
ayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefipsd
qqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygcr
viqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirgn
vlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqkm
idvaepgqrkivmhkirphiatlrkytygkhilaklekyy

Timeline for d3bsba_:

• d3bsba_ first appeared in SCOP 1.75, called d3bsba1
  
• d3bsba_ appears in SCOPe 2.02
  
• d3bsba_ appears in the current release, SCOPe 2.08