SCOPe 2.01: Domain d3brxa_: 3brx A:

Lineage for d3brxa_ (3brx A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein automated matches [190368] (3 species)
   not a true protein

7. Species Cotton (Gossypium hirsutum) [TaxId:3635] [187206] (1 PDB entry)

8. Domain d3brxa_: 3brx A: [155521]
   automated match to d1n00a_
   complexed with ca, po4

Details for d3brxa_

PDB Entry: 3brx, 2.5 Å

PDB Description: Crystal Structure of calcium-bound cotton annexin Gh1

PDB Compounds: (A:) Annexin

SCOPe Domain Sequences for d3brxa_:

Sequence; same for both SEQRES and ATOM records:

>d3brxa_ a.65.1.1 (A:) automated matches {Cotton (Gossypium hirsutum) [TaxId: 3635]}
hhatltvpttvpsvsedceqlrkafsgwgtnegliidilghrnaeqrnlirktyaetyge
dllkaldkelsndferlvllwaldpaerdallaneatkrwtssnqvlmeiactrsanqll
harqayharykksleedvahhttgdfhklllplvssyryegeevnmtlakteakllheki
snkaysdddvirvlatrskaqinatlnhykneygndinkdlkadpkdeflallrstvkcl
vypekyfekvlrlainrrgtdegaltrvvctraevdlkviadeyqrrnsvpltraivkdt
hgdyeklllvlaghven

Timeline for d3brxa_:

• d3brxa_ first appeared in SCOP 1.75, called d3brxa1
  
• d3brxa_ appears in SCOPe 2.02
  
• d3brxa_ appears in the current release, SCOPe 2.08, called d3brxa2