Class a: All alpha proteins [46456] (290 folds) |
Fold a.285: MtlR-like [158667] (1 superfamily) multihelical; 8-helical up-and-down bundle |
Superfamily a.285.1: MtlR-like [158668] (1 family) automatically mapped to Pfam PF05068 |
Family a.285.1.1: MtlR-like [158669] (2 proteins) Pfam PF05068; mannitol repressor |
Protein Mannitol operon repressor MtlR [158672] (1 species) |
Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry) Uniprot Q87SQ4 6-172 |
Domain d3brjd_: 3brj D: [155514] automated match to d3brja1 complexed with edo, gol |
PDB Entry: 3brj (more details), 2.75 Å
SCOPe Domain Sequences for d3brjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3brjd_ a.285.1.1 (D:) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]} ineseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgpl gdlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkk mgmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk
Timeline for d3brjd_: