Lineage for d3brjd_ (3brj D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739181Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 2739182Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
    automatically mapped to Pfam PF05068
  5. 2739183Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 2739184Protein Mannitol operon repressor MtlR [158672] (1 species)
  7. 2739185Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry)
    Uniprot Q87SQ4 6-172
  8. 2739189Domain d3brjd_: 3brj D: [155514]
    automated match to d3brja1
    complexed with edo, gol

Details for d3brjd_

PDB Entry: 3brj (more details), 2.75 Å

PDB Description: Crystal structure of mannitol operon repressor (MtlR) from Vibrio parahaemolyticus RIMD 2210633
PDB Compounds: (D:) Mannitol operon repressor

SCOPe Domain Sequences for d3brjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brjd_ a.285.1.1 (D:) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
ineseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgpl
gdlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkk
mgmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk

SCOPe Domain Coordinates for d3brjd_:

Click to download the PDB-style file with coordinates for d3brjd_.
(The format of our PDB-style files is described here.)

Timeline for d3brjd_: