Lineage for d3brjc1 (3brj C:6-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781418Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 781419Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
  5. 781420Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 781421Protein Mannitol operon repressor MtlR [158672] (1 species)
  7. 781422Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry)
    Uniprot Q87SQ4 6-172
  8. 781425Domain d3brjc1: 3brj C:6-172 [155513]
    automatically matched to 3BRJ A:6-172
    complexed with edo, gol

Details for d3brjc1

PDB Entry: 3brj (more details), 2.75 Å

PDB Description: Crystal structure of mannitol operon repressor (MtlR) from Vibrio parahaemolyticus RIMD 2210633
PDB Compounds: (C:) Mannitol operon repressor

SCOP Domain Sequences for d3brjc1:

Sequence, based on SEQRES records: (download)

>d3brjc1 a.285.1.1 (C:6-172) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
neseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgplg
dlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkkm
gmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk

Sequence, based on observed residues (ATOM records): (download)

>d3brjc1 a.285.1.1 (C:6-172) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
neseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgplg
dlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkkm
gmvqlevndidlefyqlqlqrqqqiiksglslaiveicnelgk

SCOP Domain Coordinates for d3brjc1:

Click to download the PDB-style file with coordinates for d3brjc1.
(The format of our PDB-style files is described here.)

Timeline for d3brjc1: