SCOPe 2.04: Domain d3bqnc_: 3bqn C:

Lineage for d3bqnc_ (3bqn C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
   Uniprot P20701 153-334

8. Domain d3bqnc_: 3bqn C: [155502]
   automated match to d1cqpa_
   complexed with bqn

Details for d3bqnc_

PDB Entry: 3bqn, 1.8 Å

PDB Description: LFA-1 I domain bound to inhibitors

PDB Compounds: (C:) Integrin alpha-L

SCOPe Domain Sequences for d3bqnc_:

Sequence; same for both SEQRES and ATOM records:

>d3bqnc_ c.62.1.1 (C:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

Timeline for d3bqnc_:

• d3bqnc_ first appeared in SCOP 1.75, called d3bqnc1
  
• d3bqnc_ appears in SCOPe 2.03
  
• d3bqnc_ appears in SCOPe 2.05
  
• d3bqnc_ appears in the current release, SCOPe 2.08