Lineage for d1fdhg_ (1fdh G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632737Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 632742Domain d1fdhg_: 1fdh G: [15550]
    Other proteins in same PDB: d1fdha_, d1fdhb_
    complexed with hem

Details for d1fdhg_

PDB Entry: 1fdh (more details), 2.5 Å

PDB Description: structure of human foetal deoxyhaemoglobin
PDB Compounds: (G:) hemoglobin f (deoxy) (gamma chain)

SCOP Domain Sequences for d1fdhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOP Domain Coordinates for d1fdhg_:

Click to download the PDB-style file with coordinates for d1fdhg_.
(The format of our PDB-style files is described here.)

Timeline for d1fdhg_: