Lineage for d1fdhg_ (1fdh G:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436496Protein Hemoglobin, beta-chain [46500] (20 species)
  7. 436792Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 436797Domain d1fdhg_: 1fdh G: [15550]
    Other proteins in same PDB: d1fdha_

Details for d1fdhg_

PDB Entry: 1fdh (more details), 2.5 Å

PDB Description: structure of human foetal deoxyhaemoglobin

SCOP Domain Sequences for d1fdhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOP Domain Coordinates for d1fdhg_:

Click to download the PDB-style file with coordinates for d1fdhg_.
(The format of our PDB-style files is described here.)

Timeline for d1fdhg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fdha_