SCOP 1.59: Domain d1fdhg_: 1fdh G:

Lineage for d1fdhg_ (1fdh G:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)

8. Domain d1fdhg_: 1fdh G: [15550]
   Other proteins in same PDB: d1fdha_

Details for d1fdhg_

PDB Entry: 1fdh, 2.5 Å

PDB Description: structure of human foetal deoxyhaemoglobin

SCOP Domain Sequences for d1fdhg_:

Sequence; same for both SEQRES and ATOM records:

>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

Timeline for d1fdhg_:

• d1fdhg_ first appeared (with stable ids) in SCOP 1.55
  
• d1fdhg_ appears in SCOP 1.57
  
• d1fdhg_ appears in SCOP 1.61
  
• d1fdhg_ appears in the current release, SCOPe 2.08