Lineage for d3bqda1 (3bqd A:525-777)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776657Protein Glucocorticoid receptor [89140] (1 species)
  7. 776658Species Human (Homo sapiens) [TaxId:9606] [89141] (4 PDB entries)
  8. 776660Domain d3bqda1: 3bqd A:525-777 [155498]
    automatically matched to d1m2za_
    complexed with day; mutant

Details for d3bqda1

PDB Entry: 3bqd (more details), 2.5 Å

PDB Description: Doubling the Size of the Glucocorticoid Receptor Ligand Binding Pocket by Deacylcortivazol
PDB Compounds: (A:) Glucocorticoid receptor

SCOP Domain Sequences for d3bqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqda1 a.123.1.1 (A:525-777) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
lpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgf
rnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpcmydqck
hmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkr
egnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipky
sngnikkllfhqk

SCOP Domain Coordinates for d3bqda1:

Click to download the PDB-style file with coordinates for d3bqda1.
(The format of our PDB-style files is described here.)

Timeline for d3bqda1: