Lineage for d3bq2a2 (3bq2 A:1-239)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884843Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 884844Protein DinB homolog (DBH) [100889] (3 species)
  7. 884920Species Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId:2285] [160954] (3 PDB entries)
  8. 884923Domain d3bq2a2: 3bq2 A:1-239 [155496]
    Other proteins in same PDB: d3bq2a1
    automatically matched to d1k1qa2
    complexed with ca

Details for d3bq2a2

PDB Entry: 3bq2 (more details), 2.7 Å

PDB Description: post-insertion binary complex of dbh dna polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d3bq2a2:

Sequence, based on SEQRES records: (download)

>d3bq2a2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

Sequence, based on observed residues (ATOM records): (download)

>d3bq2a2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgtsgavatanyearklgvkagmpiik
amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

SCOP Domain Coordinates for d3bq2a2:

Click to download the PDB-style file with coordinates for d3bq2a2.
(The format of our PDB-style files is described here.)

Timeline for d3bq2a2: