Lineage for d3bq2a1 (3bq2 A:240-344)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881225Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 881226Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 881227Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 881228Protein DinB homolog (DBH) [100881] (3 species)
  7. 881303Species Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId:2285] [160394] (3 PDB entries)
  8. 881306Domain d3bq2a1: 3bq2 A:240-344 [155495]
    Other proteins in same PDB: d3bq2a2
    automatically matched to d1k1qa1
    complexed with ca

Details for d3bq2a1

PDB Entry: 3bq2 (more details), 2.7 Å

PDB Description: post-insertion binary complex of dbh dna polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d3bq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq2a1 d.240.1.1 (A:240-344) DinB homolog (DBH) {Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId: 2285]}
nkskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskg
kkfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOP Domain Coordinates for d3bq2a1:

Click to download the PDB-style file with coordinates for d3bq2a1.
(The format of our PDB-style files is described here.)

Timeline for d3bq2a1: