Lineage for d3bq2a1 (3bq2 A:242-344)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564907Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2564908Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2564909Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2564910Protein DinB homolog (DBH) [100881] (3 species)
  7. 2564911Species Sulfolobus acidocaldarius [TaxId:2285] [160394] (3 PDB entries)
  8. 2564914Domain d3bq2a1: 3bq2 A:242-344 [155495]
    Other proteins in same PDB: d3bq2a2
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca

Details for d3bq2a1

PDB Entry: 3bq2 (more details), 2.7 Å

PDB Description: post-insertion binary complex of dbh dna polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3bq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq2a1 d.240.1.1 (A:242-344) DinB homolog (DBH) {Sulfolobus acidocaldarius [TaxId: 2285]}
skiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkk
fkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOPe Domain Coordinates for d3bq2a1:

Click to download the PDB-style file with coordinates for d3bq2a1.
(The format of our PDB-style files is described here.)

Timeline for d3bq2a1: