Lineage for d3bq1a2 (3bq1 A:1-239)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1056547Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1056548Protein DinB homolog (DBH) [100889] (3 species)
  7. 1056549Species Sulfolobus acidocaldarius [TaxId:2285] [160954] (3 PDB entries)
  8. 1056551Domain d3bq1a2: 3bq1 A:1-239 [155494]
    Other proteins in same PDB: d3bq1a1
    automatically matched to d1k1qa2
    protein/DNA complex; complexed with ca, dg3

Details for d3bq1a2

PDB Entry: 3bq1 (more details), 2.7 Å

PDB Description: Insertion ternary complex of Dbh DNA polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3bq1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq1a2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Sulfolobus acidocaldarius [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

SCOPe Domain Coordinates for d3bq1a2:

Click to download the PDB-style file with coordinates for d3bq1a2.
(The format of our PDB-style files is described here.)

Timeline for d3bq1a2: