Lineage for d3bq0a2 (3bq0 A:1-241)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. Protein DinB homolog (DBH) [100889] (3 species)
  7. Species Sulfolobus acidocaldarius [TaxId:2285] [160954] (3 PDB entries)
  8. Domain d3bq0a2: 3bq0 A:1-241 [155492]
    Other proteins in same PDB: d3bq0a1
    automated match to d1jx4a2
    protein/DNA complex; complexed with ca

Details for d3bq0a2

PDB Entry: 3bq0 (more details), 2.6 Å

PDB Description: pre-insertion binary complex of dbh dna polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3bq0a2:

Sequence, based on SEQRES records: (download)

>d3bq0a2 e.8.1.7 (A:1-241) DinB homolog (DBH) {Sulfolobus acidocaldarius [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
k

Sequence, based on observed residues (ATOM records): (download)

>d3bq0a2 e.8.1.7 (A:1-241) DinB homolog (DBH) {Sulfolobus acidocaldarius [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgtsgavatanyearklgvkagmpiik
amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenk

SCOPe Domain Coordinates for d3bq0a2 are not available.

Timeline for d3bq0a2:

Domains from same chain:
(mouse over for more information)
d3bq0a1