Lineage for d3bq0a1 (3bq0 A:242-344)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. Protein DinB homolog (DBH) [100881] (3 species)
  7. Species Sulfolobus acidocaldarius [TaxId:2285] [160394] (3 PDB entries)
  8. Domain d3bq0a1: 3bq0 A:242-344 [155491]
    Other proteins in same PDB: d3bq0a2
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca

Details for d3bq0a1

PDB Entry: 3bq0 (more details), 2.6 Å

PDB Description: pre-insertion binary complex of dbh dna polymerase
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3bq0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq0a1 d.240.1.1 (A:242-344) DinB homolog (DBH) {Sulfolobus acidocaldarius [TaxId: 2285]}
skiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkk
fkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOPe Domain Coordinates for d3bq0a1 are not available.

Timeline for d3bq0a1:

Domains from same chain:
(mouse over for more information)
d3bq0a2