Lineage for d3bpya1 (3bpy A:93-177)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762145Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)
  6. 762149Protein Afx (Foxo4) [46833] (1 species)
  7. 762150Species Human (Homo sapiens) [TaxId:9606] [46834] (2 PDB entries)
  8. 762151Domain d3bpya1: 3bpy A:93-177 [155490]
    automatically matched to d1e17a_
    complexed with mg

Details for d3bpya1

PDB Entry: 3bpy (more details), 1.87 Å

PDB Description: Crystal Structure of the DNA Binding Domain of FOXO4 Bound to DNA
PDB Compounds: (A:) Forkhead transcription factor FOXO4, DNA binding domain

SCOP Domain Sequences for d3bpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]}
rrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsirh
nlslhskfikvhneatgksswwmln

SCOP Domain Coordinates for d3bpya1:

Click to download the PDB-style file with coordinates for d3bpya1.
(The format of our PDB-style files is described here.)

Timeline for d3bpya1:

  • d3bpya1 is new in SCOP 1.75
  • d3bpya1 does not appear in SCOPe 2.01