Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins) |
Protein Afx (Foxo4) [46833] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46834] (2 PDB entries) |
Domain d3bpya1: 3bpy A:93-177 [155490] automatically matched to d1e17a_ complexed with mg |
PDB Entry: 3bpy (more details), 1.87 Å
SCOP Domain Sequences for d3bpya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} rrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsirh nlslhskfikvhneatgksswwmln
Timeline for d3bpya1: