SCOPe 2.08: Domain d3bpse2: 3bps E:293-332

Lineage for d3bpse2 (3bps E:293-332)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
   Uniprot P01130 272-353

8. Domain d3bpse2: 3bps E:293-332 [155489]
   Other proteins in same PDB: d3bpsa1, d3bpse3
   automated match to d3bpse1
   complexed with ca

Details for d3bpse2

PDB Entry: 3bps, 2.41 Å

PDB Description: PCSK9:EGF-A complex

PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d3bpse2:

Sequence; same for both SEQRES and ATOM records:

>d3bpse2 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

Timeline for d3bpse2:

• d3bpse2 first appeared in SCOP 1.75, called d3bpse1
  
• d3bpse2 appears in SCOPe 2.07