SCOPe 2.06: Domain d3bpla_: 3bpl A:

Lineage for d3bpla_ (3bpl A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (17 PDB entries)

8. Domain d3bpla_: 3bpl A: [155485]
   Other proteins in same PDB: d3bplb1, d3bplb2, d3bplb3, d3bplc1, d3bplc2
   automated match to d1itla_
   complexed with nag

Details for d3bpla_

PDB Entry: 3bpl, 2.93 Å

PDB Description: crystal structure of the il4-il4r-common gamma ternary complex

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d3bpla_:

Sequence; same for both SEQRES and ATOM records:

>d3bpla_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
cditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekd
trclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimre
kyskcs

Timeline for d3bpla_:

• d3bpla_ first appeared in SCOP 1.75, called d3bpla1
  
• d3bpla_ appears in SCOPe 2.05
  
• d3bpla_ appears in SCOPe 2.07
  
• d3bpla_ appears in the current release, SCOPe 2.08