Lineage for d1hbsf_ (1hbs F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632381Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)
  8. 632723Domain d1hbsf_: 1hbs F: [15548]
    Other proteins in same PDB: d1hbsa_, d1hbsc_, d1hbse_, d1hbsg_

Details for d1hbsf_

PDB Entry: 1hbs (more details), 3 Å

PDB Description: refined crystal structure of deoxyhemoglobin s. i. restrained least-squares refinement at 3.0-angstroms resolution
PDB Compounds: (F:) hemoglobin s (deoxy) (beta chain)

SCOP Domain Sequences for d1hbsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbsf_ a.1.1.2 (F:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1hbsf_:

Click to download the PDB-style file with coordinates for d1hbsf_.
(The format of our PDB-style files is described here.)

Timeline for d1hbsf_: