SCOP 1.75: Domain d3bp5a1: 3bp5 A:1-114

Lineage for d3bp5a1 (3bp5 A:1-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101511] (3 PDB entries)

8. Domain d3bp5a1: 3bp5 A:1-114 [155462]
   automatically matched to d1npua_
   complexed with gol; mutant

Details for d3bp5a1

PDB Entry: 3bp5, 1.8 Å

PDB Description: crystal structure of the mouse pd-1 and pd-l2 complex

PDB Compounds: (A:) Programmed cell death protein 1

SCOP Domain Sequences for d3bp5a1:

Sequence; same for both SEQRES and ATOM records:

>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvter

Timeline for d3bp5a1:

• d3bp5a1 is new in SCOP 1.75
  
• d3bp5a1 is called d3bp5a_ in SCOPe 2.01
  
• d3bp5a1 appears in the current release, SCOPe 2.08, called d3bp5a_