Lineage for d1cmyd_ (1cmy D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759107Species Human (Homo sapiens) [TaxId:9606] [46501] (177 PDB entries)
    Uniprot P68871
  8. 759456Domain d1cmyd_: 1cmy D: [15545]
    Other proteins in same PDB: d1cmya_, d1cmyc_
    complexed with hem

Details for d1cmyd_

PDB Entry: 1cmy (more details), 3 Å

PDB Description: the mutation beta99 asp-tyr stabilizes y-a new, composite quaternary state of human hemoglobin
PDB Compounds: (D:) hemoglobin ypsilanti (carbonmonoxy) (beta chain)

SCOP Domain Sequences for d1cmyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmyd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvypenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1cmyd_:

Click to download the PDB-style file with coordinates for d1cmyd_.
(The format of our PDB-style files is described here.)

Timeline for d1cmyd_: