SCOP 1.75: Domain d3bnfa1: 3bnf A:37-507

Lineage for d3bnfa1 (3bnf A:37-507)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Wolinella succinogenes [TaxId:844] [48720] (6 PDB entries)

8. Domain d3bnfa1: 3bnf A:37-507 [155438]
   automatically matched to d1fs7a_
   complexed with act, ca, hem, so3, y1

Details for d3bnfa1

PDB Entry: 3bnf, 1.7 Å

PDB Description: W. succinogenes NrfA Sulfite Complex

PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d3bnfa1:

Sequence; same for both SEQRES and ATOM records:

>d3bnfa1 a.138.1.3 (A:37-507) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

Timeline for d3bnfa1:

• d3bnfa1 is new in SCOP 1.75
  
• d3bnfa1 is called d3bnfa_ in SCOPe 2.01
  
• d3bnfa1 appears in the current release, SCOPe 2.08, called d3bnfa_