SCOPe 2.08: Domain d3bn9d2: 3bn9 D:114-214

Lineage for d3bn9d2 (3bn9 D:114-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3bn9d2: 3bn9 D:114-214 [155427]
   Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9c2, d3bn9d1, d3bn9e1, d3bn9e2, d3bn9f1
   automatically matched to d1ngzb2
   complexed with edo, so4

Details for d3bn9d2

PDB Entry: 3bn9, 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2

PDB Compounds: (D:) E2 Fab Heavy Chain

SCOPe Domain Sequences for d3bn9d2:

Sequence, based on SEQRES records:

>d3bn9d2 b.1.1.2 (D:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d3bn9d2 b.1.1.2 (D:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplaplgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
ptyicnvnhkpsntkvdkkvepk

Timeline for d3bn9d2:

• d3bn9d2 first appeared in SCOP 1.75
  
• d3bn9d2 appears in SCOPe 2.07