Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [158863] (2 PDB entries) |
Domain d3bn9d1: 3bn9 D:1-113 [155426] Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9c2, d3bn9d2, d3bn9e1, d3bn9e2, d3bn9f2 automatically matched to d1qd0a_ complexed with edo, so4 |
PDB Entry: 3bn9 (more details), 2.17 Å
SCOPe Domain Sequences for d3bn9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bn9d1 b.1.1.1 (D:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsggglvkpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy adsvkgrftisrdnskntlylqmsslraedtavyycarpyltypqrrgpqnvspfdnwgq gtmvtvss
Timeline for d3bn9d1: