Lineage for d3bmya1 (3bmy A:17-223)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871740Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 871741Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 871742Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 871743Protein HSP90 [55876] (3 species)
  7. 871801Species Human (Homo sapiens) [TaxId:9606] [55878] (45 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform
    Uniprot P07900 16-223
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 871804Domain d3bmya1: 3bmy A:17-223 [155424]
    automatically matched to d1osfa_
    complexed with cxz

Details for d3bmya1

PDB Entry: 3bmy (more details), 1.6 Å

PDB Description: Discovery of Benzisoxazoles as Potent Inhibitors of Chaperone Hsp90
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOP Domain Sequences for d3bmya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bmya1 d.122.1.1 (A:17-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

SCOP Domain Coordinates for d3bmya1:

Click to download the PDB-style file with coordinates for d3bmya1.
(The format of our PDB-style files is described here.)

Timeline for d3bmya1: