SCOP 1.75: Domain d3bmwa4: 3bmw A:1-406

Lineage for d3bmwa4 (3bmw A:1-406)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (6 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Thermoanaerobacterium [TaxId:28895] [159380] (2 PDB entries)

8. Domain d3bmwa4: 3bmw A:1-406 [155423]
   Other proteins in same PDB: d3bmwa1, d3bmwa2, d3bmwa3
   automatically matched to d1a47a4
   complexed with aci, ca, cl, g6d, glc, gol, so4; mutant

Details for d3bmwa4

PDB Entry: 3bmw, 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p complexed with a maltoheptaose inhibitor

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d3bmwa4:

Sequence; same for both SEQRES and ATOM records:

>d3bmwa4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]}
asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
indgyltgmgvtaiwipqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay

Timeline for d3bmwa4:

• d3bmwa4 is new in SCOP 1.75
  
• d3bmwa4 appears in SCOPe 2.01
  
• d3bmwa4 appears in the current release, SCOPe 2.08