SCOPe 2.01: Domain d3bmwa3: 3bmw A:407-495

Lineage for d3bmwa3 (3bmw A:407-495)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (6 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Thermoanaerobacterium [TaxId:28895] [159261] (2 PDB entries)

8. Domain d3bmwa3: 3bmw A:407-495 [155422]
   Other proteins in same PDB: d3bmwa1, d3bmwa2, d3bmwa4
   automatically matched to d1a47a3
   complexed with ca, cl, gol, so4; mutant

Details for d3bmwa3

PDB Entry: 3bmw, 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p complexed with a maltoheptaose inhibitor

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d3bmwa3:

Sequence; same for both SEQRES and ATOM records:

>d3bmwa3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

Timeline for d3bmwa3:

• d3bmwa3 first appeared in SCOP 1.75
  
• d3bmwa3 appears in SCOPe 2.02
  
• d3bmwa3 appears in the current release, SCOPe 2.08