Lineage for d3bmwa2 (3bmw A:579-683)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939144Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 939145Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 939181Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
    this domain is the last one in the protein chain
  7. 939248Species Thermoanaerobacterium [TaxId:28895] [158931] (2 PDB entries)
  8. 939250Domain d3bmwa2: 3bmw A:579-683 [155421]
    Other proteins in same PDB: d3bmwa1, d3bmwa3, d3bmwa4
    automatically matched to d1a47a2
    complexed with ca, cl, gol, so4; mutant

Details for d3bmwa2

PDB Entry: 3bmw (more details), 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p complexed with a maltoheptaose inhibitor
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d3bmwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bmwa2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOPe Domain Coordinates for d3bmwa2:

Click to download the PDB-style file with coordinates for d3bmwa2.
(The format of our PDB-style files is described here.)

Timeline for d3bmwa2: