SCOPe 2.02: Domain d3bmva2: 3bmv A:579-683

Lineage for d3bmva2 (3bmv A:579-683)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (4 PDB entries)

8. Domain d3bmva2: 3bmv A:579-683 [155417]
   Other proteins in same PDB: d3bmva1, d3bmva3, d3bmva4
   automatically matched to d1a47a2
   complexed with ca, gol, so4; mutant

Details for d3bmva2

PDB Entry: 3bmv, 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d3bmva2:

Sequence; same for both SEQRES and ATOM records:

>d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

Timeline for d3bmva2:

• d3bmva2 first appeared in SCOP 1.75
  
• d3bmva2 appears in SCOPe 2.01
  
• d3bmva2 appears in SCOPe 2.03
  
• d3bmva2 appears in the current release, SCOPe 2.08