Lineage for d3bmva2 (3bmv A:579-683)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790368Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 790404Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
    this domain is the last one in the protein chain
  7. 790471Species Thermoanaerobacterium [TaxId:28895] [158931] (2 PDB entries)
  8. 790472Domain d3bmva2: 3bmv A:579-683 [155417]
    Other proteins in same PDB: d3bmva1, d3bmva3, d3bmva4
    automatically matched to d1a47a2
    complexed with ca, gol, so4; mutant

Details for d3bmva2

PDB Entry: 3bmv (more details), 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d3bmva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOP Domain Coordinates for d3bmva2:

Click to download the PDB-style file with coordinates for d3bmva2.
(The format of our PDB-style files is described here.)

Timeline for d3bmva2: