Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (4 PDB entries) |
Domain d3bmva1: 3bmv A:496-578 [155416] Other proteins in same PDB: d3bmva2, d3bmva3, d3bmva4 automated match to d3bmva1 complexed with ca, gol, so4; mutant |
PDB Entry: 3bmv (more details), 1.6 Å
SCOPe Domain Sequences for d3bmva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp gkynislktssgatsntynnini
Timeline for d3bmva1: