Lineage for d3bmva1 (3bmv A:496-578)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770292Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1770338Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 1770399Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (4 PDB entries)
  8. 1770400Domain d3bmva1: 3bmv A:496-578 [155416]
    Other proteins in same PDB: d3bmva2, d3bmva3, d3bmva4
    automated match to d3bmva1
    complexed with ca, gol, so4; mutant

Details for d3bmva1

PDB Entry: 3bmv (more details), 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d3bmva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

SCOPe Domain Coordinates for d3bmva1:

Click to download the PDB-style file with coordinates for d3bmva1.
(The format of our PDB-style files is described here.)

Timeline for d3bmva1: