Lineage for d1glid_ (1gli D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300599Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries)
    Uniprot P68871
  8. 2301032Domain d1glid_: 1gli D: [15535]
    Other proteins in same PDB: d1glia_, d1glic_
    complexed with hem, po4

Details for d1glid_

PDB Entry: 1gli (more details), 2.5 Å

PDB Description: deoxyhemoglobin t38w (alpha chains), v1g (alpha and beta chains)
PDB Compounds: (D:) deoxyhemoglobin

SCOPe Domain Sequences for d1glid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glid_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1glid_:

Click to download the PDB-style file with coordinates for d1glid_.
(The format of our PDB-style files is described here.)

Timeline for d1glid_: