SCOP 1.75: Domain d3bj3b1: 3bj3 B:1-146

Lineage for d3bj3b1 (3bj3 B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
   Uniprot P83273; 86% sequence identity

8. Domain d3bj3b1: 3bj3 B:1-146 [155327]
   automatically matched to d1xq5b_
   complexed with ace, hem

Details for d3bj3b1

PDB Entry: 3bj3, 2.1 Å

PDB Description: met-Perch hemoglobin at pH 8.0

PDB Compounds: (B:) hemoglobin beta

SCOP Domain Sequences for d3bj3b1:

Sequence; same for both SEQRES and ATOM records:

>d3bj3b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

Timeline for d3bj3b1:

• d3bj3b1 is new in SCOP 1.75
  
• d3bj3b1 is called d3bj3b_ in SCOPe 2.01
  
• d3bj3b1 appears in the current release, SCOPe 2.08, called d3bj3b_