SCOPe 2.06: Domain d3biwf1: 3biw F:82-288

Lineage for d3biwf1 (3biw F:82-288)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)

8. Domain d3biwf1: 3biw F:82-288 [155320]
   automatically matched to d1c4rg_
   complexed with ca, nag

Details for d3biwf1

PDB Entry: 3biw, 3.5 Å

PDB Description: crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex

PDB Compounds: (F:) Neurexin-1-beta

SCOPe Domain Sequences for d3biwf1:

Sequence; same for both SEQRES and ATOM records:

>d3biwf1 b.29.1.4 (F:82-288) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

Timeline for d3biwf1:

• d3biwf1 first appeared in SCOP 1.75
  
• d3biwf1 appears in SCOPe 2.05
  
• d3biwf1 appears in SCOPe 2.07
  
• d3biwf1 appears in the current release, SCOPe 2.08