Lineage for d3biie1 (3bii E:2-150)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859091Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 859341Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family) (S)
  5. 859342Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
  6. 859343Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 859344Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)
  8. 859354Domain d3biie1: 3bii E:2-150 [155308]
    Other proteins in same PDB: d3biid1
    automatically matched to d1fm0e_
    complexed with cl

Details for d3biie1

PDB Entry: 3bii (more details), 2.5 Å

PDB Description: crystal structure of activated mpt synthase
PDB Compounds: (E:) Molybdopterin-converting factor subunit 2

SCOP Domain Sequences for d3biie1:

Sequence, based on SEQRES records: (download)

>d3biie1 d.41.5.1 (E:2-150) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records): (download)

>d3biie1 d.41.5.1 (E:2-150) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

SCOP Domain Coordinates for d3biie1:

Click to download the PDB-style file with coordinates for d3biie1.
(The format of our PDB-style files is described here.)

Timeline for d3biie1: