Lineage for d3bi1a1 (3bi1 A:594-750)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714598Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2714599Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2714600Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 2714601Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries)
    Uniprot Q04609 594-750
  8. 2714603Domain d3bi1a1: 3bi1 A:594-750 [155295]
    Other proteins in same PDB: d3bi1a2, d3bi1a3
    automatically matched to d1z8la1
    complexed with 3bi, ca, cl, nag, zn

Details for d3bi1a1

PDB Entry: 3bi1 (more details), 1.5 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d3bi1a1:

Sequence, based on SEQRES records: (download)

>d3bi1a1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d3bi1a1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d3bi1a1:

Click to download the PDB-style file with coordinates for d3bi1a1.
(The format of our PDB-style files is described here.)

Timeline for d3bi1a1: