SCOPe 2.02: Domain d3bhvd1: 3bhv D:181-308

Lineage for d3bhvd1 (3bhv D:181-308)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (8 PDB entries)

8. Domain d3bhvd1: 3bhv D:181-308 [155287]
   Other proteins in same PDB: d3bhva_, d3bhvc_
   automatically matched to d1vina1
   complexed with mg, sgm, var

Details for d3bhvd1

PDB Entry: 3bhv, 2.1 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor variolin B

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3bhvd1:

Sequence; same for both SEQRES and ATOM records:

>d3bhvd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa

Timeline for d3bhvd1:

• d3bhvd1 first appeared in SCOP 1.75
  
• d3bhvd1 appears in SCOPe 2.01
  
• d3bhvd1 appears in SCOPe 2.03
  
• d3bhvd1 appears in the current release, SCOPe 2.08