SCOPe 2.04: Domain d3bhub2: 3bhu B:309-432

Lineage for d3bhub2 (3bhu B:309-432)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)

8. Domain d3bhub2: 3bhu B:309-432 [155282]
   Other proteins in same PDB: d3bhua_, d3bhuc_
   automated match to d1vina2
   complexed with mg, mhr

Details for d3bhub2

PDB Entry: 3bhu, 2.3 Å

PDB Description: structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor meriolin 5

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3bhub2:

Sequence; same for both SEQRES and ATOM records:

>d3bhub2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

Timeline for d3bhub2:

• d3bhub2 first appeared in SCOP 1.75
  
• d3bhub2 appears in SCOPe 2.03
  
• d3bhub2 appears in SCOPe 2.05
  
• d3bhub2 appears in the current release, SCOPe 2.08