Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) |
Domain d3bhub1: 3bhu B:171-308 [155281] Other proteins in same PDB: d3bhua1, d3bhua2, d3bhuc1, d3bhuc2 automated match to d3ddqb1 complexed with mg, mhr |
PDB Entry: 3bhu (more details), 2.3 Å
SCOPe Domain Sequences for d3bhub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhub1 a.74.1.1 (B:171-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq vlrmehlvlkvlafdlaa
Timeline for d3bhub1: