Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (8 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (8 PDB entries) |
Domain d3bhtb1: 3bht B:181-308 [155277] Other proteins in same PDB: d3bhta_, d3bhtc_ automatically matched to d1vina1 complexed with mfr, mg, sgm |
PDB Entry: 3bht (more details), 2 Å
SCOPe Domain Sequences for d3bhtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhtb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vlafdlaa
Timeline for d3bhtb1:
View in 3D Domains from other chains: (mouse over for more information) d3bhta_, d3bhtc_, d3bhtd1, d3bhtd2 |