Lineage for d3bf3f1 (3bf3 F:1-118)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836615Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 836616Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 836631Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
    Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245
  8. 836654Domain d3bf3f1: 3bf3 F:1-118 [155232]
    automatically matched to d2gtda1
    complexed with mg, paz

Details for d3bf3f1

PDB Entry: 3bf3 (more details), 1.63 Å

PDB Description: Type III pantothenate kinase from Thermotoga maritima complexed with product phosphopantothenate
PDB Compounds: (F:) Type III pantothenate kinase

SCOP Domain Sequences for d3bf3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bf3f1 c.55.1.13 (F:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
myllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgigva
svvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkeyg

SCOP Domain Coordinates for d3bf3f1:

Click to download the PDB-style file with coordinates for d3bf3f1.
(The format of our PDB-style files is described here.)

Timeline for d3bf3f1: