Lineage for d3begb_ (3beg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952294Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species)
  7. 2952295Species Human (Homo sapiens) [TaxId:9606] [143347] (3 PDB entries)
    Uniprot Q07955 1-95
  8. 2952296Domain d3begb_: 3beg B: [155185]
    automated match to d1x4ca1
    protein/RNA complex; complexed with ala, anp, sep

Details for d3begb_

PDB Entry: 3beg (more details), 2.9 Å

PDB Description: crystal structure of sr protein kinase 1 complexed to its substrate asf/sf2
PDB Compounds: (B:) Splicing factor, arginine/serine-rich 1

SCOPe Domain Sequences for d3begb_:

Sequence, based on SEQRES records: (download)

>d3begb_ d.58.7.1 (B:) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}
nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf
rshegetayirvkvdgprspsygrsrsrsr

Sequence, based on observed residues (ATOM records): (download)

>d3begb_ d.58.7.1 (B:) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}
nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf
rshegetayirvkvdgsygrsrsrsr

SCOPe Domain Coordinates for d3begb_:

Click to download the PDB-style file with coordinates for d3begb_.
(The format of our PDB-style files is described here.)

Timeline for d3begb_: