Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [143347] (3 PDB entries) Uniprot Q07955 1-95 |
Domain d3begb_: 3beg B: [155185] automated match to d1x4ca1 protein/RNA complex; complexed with ala, anp, sep |
PDB Entry: 3beg (more details), 2.9 Å
SCOPe Domain Sequences for d3begb_:
Sequence, based on SEQRES records: (download)
>d3begb_ d.58.7.1 (B:) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf rshegetayirvkvdgprspsygrsrsrsr
>d3begb_ d.58.7.1 (B:) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf rshegetayirvkvdgsygrsrsrsr
Timeline for d3begb_: