Lineage for d3bdmy_ (3bdm Y:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2551136Domain d3bdmy_: 3bdm Y: [155152]
    Other proteins in same PDB: d3bdma_, d3bdmb_, d3bdmc_, d3bdmd_, d3bdme_, d3bdmf_, d3bdmg_, d3bdmh_, d3bdml_, d3bdmo_, d3bdmp_, d3bdmq_, d3bdmr_, d3bdms_, d3bdmt_, d3bdmu_, d3bdmv_, d3bdmz_
    automated match to d1g0uk_
    complexed with gdt

Details for d3bdmy_

PDB Entry: 3bdm (more details), 2.7 Å

PDB Description: yeast 20S proteasome:glidobactin A-complex
PDB Compounds: (Y:) Proteasome component PRE2

SCOPe Domain Sequences for d3bdmy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdmy_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d3bdmy_:

Click to download the PDB-style file with coordinates for d3bdmy_.
(The format of our PDB-style files is described here.)

Timeline for d3bdmy_: