Lineage for d3bdmp_ (3bdm P:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)
  8. 1045735Domain d3bdmp_: 3bdm P: [155144]
    Other proteins in same PDB: d3bdm01, d3bdm1_, d3bdma_, d3bdme_, d3bdmf1, d3bdmi_, d3bdmj_, d3bdmk_, d3bdmm1, d3bdmn_, d3bdmo_, d3bdms_, d3bdmt1, d3bdmw_, d3bdmx_, d3bdmy_
    automated match to d1g65b_
    complexed with gdt

Details for d3bdmp_

PDB Entry: 3bdm (more details), 2.7 Å

PDB Description: yeast 20S proteasome:glidobactin A-complex
PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d3bdmp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdmp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d3bdmp_:

Click to download the PDB-style file with coordinates for d3bdmp_.
(The format of our PDB-style files is described here.)

Timeline for d3bdmp_: