SCOPe 2.01: Domain d3bdmo_: 3bdm O:

Lineage for d3bdmo_ (3bdm O:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (28 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3bdmo_: 3bdm O: [155143]
   Other proteins in same PDB: d3bdm01, d3bdm1_, d3bdmb_, d3bdmc_, d3bdmg_, d3bdmh_, d3bdmi_, d3bdmj_, d3bdmk_, d3bdml_, d3bdmm1, d3bdmn_, d3bdmp_, d3bdmq_, d3bdmu_, d3bdmv_, d3bdmw_, d3bdmx_, d3bdmy_, d3bdmz_
   automated match to d1g65a_
   complexed with gdt

Details for d3bdmo_

PDB Entry: 3bdm, 2.7 Å

PDB Description: yeast 20S proteasome:glidobactin A-complex

PDB Compounds: (O:) Proteasome component Y7

SCOPe Domain Sequences for d3bdmo_:

Sequence; same for both SEQRES and ATOM records:

>d3bdmo_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

Timeline for d3bdmo_:

• d3bdmo_ first appeared in SCOP 1.75, called d3bdmo1
  
• d3bdmo_ appears in SCOPe 2.02
  
• d3bdmo_ appears in the current release, SCOPe 2.08