Lineage for d3bdm01 (3bdm 0:-8-211)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045428Domain d3bdm01: 3bdm 0:-8-211 [155128]
    Other proteins in same PDB: d3bdma_, d3bdmb_, d3bdmc_, d3bdme_, d3bdmf1, d3bdmg_, d3bdmh_, d3bdml_, d3bdmo_, d3bdmp_, d3bdmq_, d3bdms_, d3bdmt1, d3bdmu_, d3bdmv_, d3bdmz_
    automatically matched to d1g0u1_
    complexed with gdt

Details for d3bdm01

PDB Entry: 3bdm (more details), 2.7 Å

PDB Description: yeast 20S proteasome:glidobactin A-complex
PDB Compounds: (0:) Proteasome component PRE4

SCOPe Domain Sequences for d3bdm01:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdm01 d.153.1.4 (0:-8-211) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d3bdm01:

Click to download the PDB-style file with coordinates for d3bdm01.
(The format of our PDB-style files is described here.)

Timeline for d3bdm01: