Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Escherichia coli [TaxId:562] [159878] (28 PDB entries) Uniprot P02424 1-99 |
Domain d3bbxt1: 3bbx T:1-99 [155117] Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 automatically matched to 2AW4 T:1-99 protein/RNA complex; complexed with mg |
PDB Entry: 3bbx (more details), 10 Å
SCOPe Domain Sequences for d3bbxt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbxt1 d.12.1.1 (T:1-99) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} mireerllkvlraphvsekastameksntivlkvakdatkaeikaavqklfevevevvnt lvvkgkvkrhgqrigrrsdwkkayvtlkegqnldfvgga
Timeline for d3bbxt1:
View in 3D Domains from other chains: (mouse over for more information) d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 |