SCOPe 2.06: Domain d3bbxh2: 3bbx H:1-58

Lineage for d3bbxh2 (3bbx H:1-58)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d3bbxh2: 3bbx H:1-58 [155106]
   Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1
   automatically matched to 2AW4 H:1-58
   protein/RNA complex; complexed with mg

Details for d3bbxh2

PDB Entry: 3bbx, 10 Å

PDB Description: the hsp15 protein fitted into the low resolution cryo-em map of the 50s.nc-trna.hsp15 complex

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d3bbxh2:

Sequence; same for both SEQRES and ATOM records:

>d3bbxh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d3bbxh2:

• d3bbxh2 first appeared in SCOP 1.75
  
• d3bbxh2 appears in SCOPe 2.05
  
• d3bbxh2 appears in SCOPe 2.07
  
• d3bbxh2 appears in the current release, SCOPe 2.08